[Date Prev][Date Next][Thread Prev][Thread Next][Date Index][Thread Index]
Using a model file as one of the templates (fwd)
- To: modeller-care@ucsf.edu
- Subject: Using a model file as one of the templates (fwd)
- From: sasson iris <sassonir AT cs.bgu.ac.il>
- Date: Thu, 10 Jul 2003 17:03:51 +0300 (IDT)
- Cc: modeller_usage@listsrv.ucsf.edu
Hi,
I send this question again because i got no reply.
I want to create a model using modeller from a group of alignmnets and
models. Since modeller (if i understand correctly) uses only alignments
and no models (pdb format), i would like to create alignmnets from the
models i have, and give the alignment as one of the alignmnets in the
multiple alignmnet given as input to modeller. However, i have no idea how
to do this since i do not know what modeller actually does.
An alignment that may be created from a model i already have
is of identical sequences of query and template like this:
>P1;str
structure : str : : : : : : : :
EFSVCGGRLIKLSHNSNSTKTSMNVNIYLPKHYYAQDFPRNKRIPTVFYLSGLTCTPDNASEKAFWQFQADKYGFAIVFP
EHLKPELLLEAVKATSWQDYVEIKKVHGFDHSYYFVSTFVPEHAEFHARNLGLI*
>P1;query
sequence : query : : : : : : : :
EFSVCGGRLIKLSHNSNSTKTSMNVNIYLPKHYYAQDFPRNKRIPTVFYLSGLTCTPDNASEKAFWQFQADKYGFAIVFP
EHLKPELLLEAVKATSWQDYVEIKKVHGFDHSYYFVSTFVPEHAEFHARNLGLI*
and i have the model which is the str.pdb file.
I do not want modeller to put higher weight to this alignment than to the
others (which are to real templates). The sequence identity may yield this
result. How can i solve this?
Or if i ask it differently, what weight does modeller give to such
alignmnets? How can i change the sequence similarity to yield the required
result?
I will be happy to check any suggestion you may have.
Thanks,
Iris.
---------- Forwarded message ----------
Date: Sun, 6 Jul 2003 15:37:31 +0300 (IDT)
From: sasson iris <sassonir AT cs.bgu.ac.il>
To: Modeller Care <modeller-care@ucsf.edu>
Cc: modeller_usage@listsrv.ucsf.edu
Subject: Using a model file as one of the templates
Hi,
I want to use models as well as templates to build a new model using
modeller. That is, I have a few models that were not created by using an
alignment and some alignments.
How can i make modeller use all of which to build a new model?
Thanks,
Iris.