[Date Prev][Date Next][Thread Prev][Thread Next][Date Index][Thread Index]
Re: [modeller_usage] helix alignment with gap
- To: modeller_usage@listsrv.ucsf.edu
- Subject: Re: [modeller_usage] helix alignment with gap
- From: Guillaume LETELLIER <guillaume.letellier AT cea.fr>
- Date: Thu, 02 Feb 2006 17:03:23 +0100
Vivek Sharma wrote:
Hi,
May be you would like to have a look to MODELLER's ALPHA restraints.
They take the helical gaps into consideration very nicely. Prevents
kinking and keeps the faces nicely.
Hope it helps.
Indeed it helped !
I had already try the alpha constraint, but i was applying it only to
the gapped residues. I just realized that modeller works much better
when applying the constraint to the whole helix length.
Thank you very much.
Hi Guillaume,
I'm a little confuse about your explanation...the gap is real or not?
Hi Helena, and thank you for answering my unclear question.
Probably you will need to write to those who modelled the structures
before to ask about this gap. i think is really unusual that someone
could published structures that have wrong alignments...
This is right, i should probably have started here.
I was very surprised by these data, and i've checked every possible
confusion, but there's no doubt i'm working on the same structure and
sequences.
For me, the gap in the helix is really obvious, although it seems to
have been ignored in previous papers.
here's the 'reference' alignment of the helix sequence found in the
literatture :
> PLNYILLNLAVADLFMVFGGFTTTLYTSLH
> VNNYFLLSLACADLIIGTFSMNLYTTYLLM
** ** ** *** . *
and here's the one I use :
> PLNYILLNLAVADLFMVFGGFTTTLYTSLH--
> VNNYFLLSLACADL--IIGTFSMNLYTTYLLM
** ** ** *** : * *: ***:
...
Guillaume
begin:vcard
fn:LETELLIER Guillaume
n:LETELLIER;Guillaume
org;quoted-printable:Laboratoire de structure des prot=C3=A9ines;CEA - Saclay, DSV/DIEP
adr;quoted-printable:Bat. 152, porte 24;;CEA - Centre de Saclay - DIEP/ Laboratoire de structure des prot=C3=A9ine=
s;Gif-sur-Yvette Cedex;;91191;France
email;internet:guillaume.letellier AT cea.fr
title:PhD student
tel;work:01 69 08 81 53
x-mozilla-html:FALSE
version:2.1
end:vcard