[Date Prev][Date Next][Thread Prev][Thread Next][Date Index][Thread Index]
[modeller_usage] Re: Generating a model using multiple templates with different ligands
- To: modeller_usage@listsrv.ucsf.edu
- Subject: [modeller_usage] Re: Generating a model using multiple templates with different ligands
- From: Modeller Caretaker <modeller-care@ucsf.edu>
- Date: Tue, 20 Sep 2022 14:57:25 -0700
On 9/20/22 12:54 PM, Franceschini Ghilardi, Amanda (BIDMC - Lijun Sun -
General Surg SF) via modeller_usage wrote:
> I have been trying to generate a model of the AhR using three different
> templates with different ligands in each of them. When I submit the
> script for the model building, I get the error below:
>
> "_modeller.ModellerError: read_te_290E> Number of residues in the
> alignment and pdb files are different:110 109 For alignment entry:13f1o_pasA"
The sequence in your alignment file must match that in the PDB file exactly.
The "236:A:+109:A" syntax in your alignment file header instructs
Modeller to read residues from the PDB file starting at residue 236 in
chain A, and ending once it hits the end of the file or has read 109
residues, whichever happens first.
> I tried changing the number highlighted in the alignment file to 110,
> but the same error appeared.
In that case you must have reached the end of the file.
See also https://salilab.org/modeller/FAQ.html#17
> Also, since I would like to consider the three ligands, is
> that correct to add three dots at the end of the alignment and pap file?
Yes, you would need three dots in your target sequence. Align each dot
with a dot in the relevant template, and Modeller will copy the ligand
from template to target.
> _aln.pos 70 80 90 100 110
> 3f1o_pasA QVVSGQYRMLAKHGGYVWLETQGTVIYN-----PQCIMCVNYVLSEIEK/.--
> 3h7w_pasA QVVSGQYRMLAKHGGYVWLETQGTVIY------PQCIMCVNYVLSEIEK/.--
> 3h82_pasA QVVSGQYRMLAKHGGYVWLETQGTVIYNPRNLQPQCIMCVNYVLSEIEK/.--
> AhR ESGMIVFRLLTKNNRWTWVQSNARLLYK--NGRPDYIIVTQRPLTDEEG/...
> _consrvd * * * * * * * * *
This isn't right - you have asked Modeller to take the first ligand from
all three templates (you will likely get a nonsensical ligand containing
atoms from all three template ligands) and have not told it where to get
the other two ligands from. You need to add gaps to your alignment so
that the dots line up correctly, just as is done for amino acids. For
example, if the first ligand should come from the first template, the
second ligand from the second template, and the third ligand from the
third template, your alignment would look like:
>P1;3f1o_pasA
...
SEIEK/.--*
>P1;3h7w_pasA
...
SEIEK/-.-*
>P1;3h82_pasA
...
SEIEK/--.*
>P1;AhR
...
TDEEG/...*
Ben Webb, Modeller Caretaker
--
modeller-care@ucsf.edu https://salilab.org/modeller/
Modeller mail list: https://salilab.org/mailman/listinfo/modeller_usage