Modeller logo

Tutorial


Iterative example:
The alignment-modeling-evaluation cycle. The case of the Haloferax volcanii dihydrofolate reductase.

All input and output files for this example are available to download, in either zip format (for Windows) or .tar.gz format (for Unix/Linux).

Several structures of dihydrofolate reductase (DHFR) are known. However, the structure of DHFR from Haloferax volcanii was not known and its sequence identity with DHFRs of known structure is rather low at ~30%. A model of H. volcanii DHFR (HVDFR) was constructed before the experimental structure was solved. This example illustrates the power of the iterative alignment-modeling-evaluation approach to comparative modeling.

Of all the available DHFR structures, HVDHFR has the sequence most similar to DHFR from E. coli. The PDB entry 4dfr corresponds to a high resolution (1.7Å) E. coli DHFR structure. It contains two copies of the molecule, named chain A and chain B. According to the authors, the structure for chain B is of better quality than that of chain A. The following script file aligns HVDFR and chain B of 4dfr.

from modeller import *

env = environ()
mdl = model(env, file='4dfr.pdb', model_segment=('FIRST:B', 'LAST:B'))
aln = alignment(env)
aln.append_model(mdl, align_codes='4dfr')
aln.append(file='hvdfr.seq', align_codes='hvdfr')
aln.align2d()
aln.write(file='hvdfr-4dfr.ali')
aln.write(file='hvdfr-4dfr.pap', alignment_format='PAP',
          alignment_features='INDICES HELIX BETA')

File: align2d-4.py

Some options used in this example include model_segment, which is used to indicate chain B of 4dfr; and alignment_features, which is used to output information such as secondary structure to the alignment file in the PAP format.

 _aln.pos         10        20        30        40        50        60
4dfr      -MISLIAALAVDRVIGMENAMPW-NLPADLAWFKRNTLDKPVIMGRHTWESIGRPLPGRKNIILSSQ- 
hvdfr     MELVSVAALAENRVIGRDGELPWPSIPADKKQYRSRIADDPVVLGRTTFESMRDDLPGSAQIVMSRSE 
 _helix                            999999999999       999999999
 _beta     9999999999                           999999             99999999

 _aln.p   70        80        90       100       110       120       130
4dfr      -PGTDDRVTWVKSVDEAIAACG--DVPEIMVIGGGRVYEQFLPKAQKLYLTHIDAEVEGDTHFPDYEP 
hvdfr     RSFSVDTAHRAASVEEAVDIAASLDAETAYVIGGAAIYALFQPHLDRMVLSRVPGEYEGDTYYPEWDA 
 _helix               9999999999           99999999
 _beta           99999              9999999            999999999

 _aln.pos  140       150       160
4dfr      DDWESVFSEFHDADAQNSHSYCFKILERR 
hvdfr     AEWELDAETDHEG---FTLQEWVRSASSR 
 _helix
 _beta     999999999999    999999999999

File: hvdfr-4dfr.pap

Using the PIR alignment file hvdfr-4dfr.ali, an initial model is calculated:

from modeller import *
from modeller.automodel import *

env = environ()
a = automodel(env, alnfile='hvdfr-4dfr.ali',
              knowns='4dfr', sequence='hvdfr')
a.starting_model = 1
a.ending_model = 1
a.make()

File: model4.py

Because the sequence identity between 4dfr and HVDFR is relatively low (30%), the automated alignment is likely to contain errors. The evaluation of the model with the DOPE potential in MODELLER shows two regions with positive energy.

PROSAII profile for model initial model

DOPE score profile for model inihvdfr.B99990001.pdb

The first region is around residue 85, the second region is at the C-terminal end of the protein. Referring to the target--template alignment above (hvdfr-4dfr.pap), it is easy to understand why the first positive peak appears. The insertion between position 85 and 88 of the alignment was placed in the middle of an α-helix in the template (the "9" characters on the first line below the sequence mark the helices). Moving the insertion to the end of the α-helix may improve the model.

The second problem, which occurs in the C-terminal region of the alignment, is less clear. The deletion in that region of the alignment corresponds to the loop between the last two β-strands of 4dfr (a β-hairpin). Since the profile suggests that this region is in error, an alternative alignment should be tried. One possibility is that the deletion is actually longer, making the C-terminal β-hairpin shorter in HVDFR. One plausible alignment based on these considerations is shown here.

 _aln.pos         10        20        30        40        50        60
4dfr      M-ISLIAALAVDRVIGMENAMPW-NLPADLAWFKRNTLDKPVIMGRHTWESIGRPLPGRK 
hvdfr     MELVSVAALAENRVIGRDGELPWPSIPADKKQYRSRIADDPVVLGRTTFESMRDDLPGSA 
 _helix                            999999999999       999999999
 _beta    9 999999999                           999999             999


 _aln.pos         70        80        90       100       110       120
4dfr      NIILSSQPGT--DDRVTWVKSVDEAIAACG--DVPEIMVIGGGRVYEQFLPKAQKLYLTH 
hvdfr     QIVMSRSERSFSVDTAHRAASVEEAVDIAASLDAETAYVIGGAAIYALFQPHLDRMVLSR 
 _helix                       9999999999           99999999
 _beta    99999          99999              9999999            9999999


 _aln.pos        130       140       150       160
4dfr      IDAEVEGDTHFPDYEPDDWESVFSEFHDADAQNSHSYCFKILERR---- 
hvdfr     VPGEYEGDTYYPEWDAAEWELDAETDHE-------GFTLQEWVRSASSR 
 _helix
 _beta    99               999999999999    999999999999

File: hvdfr-4dfr-2.pap

A new model was calculated using this alignment and the script, modified to use the new alignment (see file `model5.py'). Its DOPE score profile is shown in the next figure.

DOPE profile for model hvdfr.B99990001.pdb

DOPE profile for model hvdfr.B99990001.pdb

The main positive peak disappeared and the new global DOPE score dropped from -15498.7 to -15720.3.

The process outlined here could be iterated until no improvement in the evaluation can be achieved. This iterative alignment-building-evaluation process has been developed in the MOULDER protocol which will be further implemented in MODELLER .