Tutorial
Basic example:
Modeling lactate dehydrogenase from Trichomonas vaginalis based on a
single template.
All input and output files for this example are available to download,
in either zip format (for Windows) or
.tar.gz format (for Unix/Linux).
A novel gene for lactate dehydrogenase was identified from the genomic
sequence of Trichomonas vaginalis (TvLDH). The corresponding protein
had a higher similarity to the malate dehydrogenase of the same species (TvMDH)
than to any other LDH. We hypothesized that TvLDH arose from TvMDH by
convergent evolution relatively recently. Comparative models were constructed
for TvLDH and TvMDH to study the sequences in the structural context and to
suggest site-directed mutagenesis experiments for elucidating specificity
changes in this apparent case of convergent evolution of enzymatic specificity.
The native and mutated enzymes were expressed and their activities were
compared.
The individual modeling steps of this example are explained below. Note
that we go through every step in this tutorial to build a model knowing only
the amino acid sequence. In practice you may already know the related
structures, and may even have an alignment from another program, so you can
skip one or more steps. Alternatively, for very simple applications you
may be able to use the ModWeb web server rather than
Modeller itself.
1. Searching for structures related to TvLDH
First, it is necessary to put the target TvLDH sequence into the PIR format
readable by MODELLER (file
"TvLDH.ali").
>P1;TvLDH
sequence:TvLDH:::::::0.00: 0.00
MSEAAHVLITGAAGQIGYILSHWIASGELYGDRQVYLHLLDIPPAMNRLTALTMELEDCAFPHLAGFVATTDPKA
AFKDIDCAFLVASMPLKPGQVRADLISSNSVIFKNTGEYLSKWAKPSVKVLVIGNPDNTNCEIAMLHAKNLKPEN
FSSLSMLDQNRAYYEVASKLGVDVKDVHDIIVWGNHGESMVADLTQATFTKEGKTQKVVDVLDHDYVFDTFFKKI
GHRAWDILEHRGFTSAASPTKAAIQHMKAWLFGTAPGEVLSMGIPVPEGNPYGIKPGVVFSFPCNVDKEGKIHVV
EGFKVNDWLREKLDFTEKDLFHEKEIALNHLAQGG*
File: TvLDH.ali
The first line contains the sequence code, in the format
">P1;code". The second line with ten fields separated by colons
generally contains information about the structure file, if applicable. Only
two of these fields are used for sequences, "sequence" (indicating
that the file contains a sequence without known structure) and "TvLDH"
(the model file name). The rest of the file contains the sequence of TvLDH,
with "*" marking its end. The standard one-letter amino acid codes are used.
(Note that they must be upper case; some lower case letters are used for
non-standard residues. See the file modlib/restyp.lib in the
Modeller distribution for more information.)
A search for potentially related sequences of known
structure can be performed by the profile.build() command of
MODELLER. The following script, taken line by line,
does the following (see file "build_profile.py"):
- Initializes the 'environment' for this modeling run, by creating a new
'environ' object. Almost all MODELLER scripts require this step, as the new
object (which we call here 'env', but you can call it anything you like) is
needed to build most other useful objects.
- Creates a new 'sequence_db' object, calling it 'sdb'. 'sequence_db'
objects are used to contain large databases of protein sequences.
- Reads a text format file containing non-redundant PDB sequences at 95%
sequence identity into the sdb database. The sequences can be found
in the file "pdb_95.pir" (which can be downloaded
using the link at the top of this page). Like the
previously-created alignment, this file is in PIR format. Sequences which
have fewer than 30 or more than 4000 residues are discarded, and non-standard
residues are removed.
- Writes a binary machine-specific file containing all sequences read in the
previous step.
- Reads the binary format file back in. Note that if you plan to use the
same database several times, you should use the previous two steps only the
first time, to produce the binary database. On subsequent runs, you can omit
those two steps and use the binary file directly, since reading the binary
file is a lot faster than reading the PIR file.
- Creates a new 'alignment' object, calling it 'aln', reads our query
sequence "TvLDH" from the file
"TvLDH.ali", and converts it to a profile
'prf'. Profiles contain similar information to alignments, but are more
compact and better for sequence database searching.
- Searches the sequence database 'sdb' for our query profile 'prf'.
Matches from the sequence database are added to the profile.
- Writes a profile of the query sequence and its homologs (see file
"build_profile.prf"). The equivalent information
is also written out in standard alignment format.
from modeller import *
log.verbose()
env = environ()
#-- Prepare the input files
#-- Read in the sequence database
sdb = sequence_db(env)
sdb.read(seq_database_file='pdb_95.pir', seq_database_format='PIR',
chains_list='ALL', minmax_db_seq_len=(30, 4000), clean_sequences=True)
#-- Write the sequence database in binary form
sdb.write(seq_database_file='pdb_95.bin', seq_database_format='BINARY',
chains_list='ALL')
#-- Now, read in the binary database
sdb.read(seq_database_file='pdb_95.bin', seq_database_format='BINARY',
chains_list='ALL')
#-- Read in the target sequence/alignment
aln = alignment(env)
aln.append(file='TvLDH.ali', alignment_format='PIR', align_codes='ALL')
#-- Convert the input sequence/alignment into
# profile format
prf = aln.to_profile()
#-- Scan sequence database to pick up homologous sequences
prf.build(sdb, matrix_offset=-450, rr_file='${LIB}/blosum62.sim.mat',
gap_penalties_1d=(-500, -50), n_prof_iterations=1,
check_profile=False, max_aln_evalue=0.01)
#-- Write out the profile in text format
prf.write(file='build_profile.prf', profile_format='TEXT')
#-- Convert the profile back to alignment format
aln = prf.to_alignment()
#-- Write out the alignment file
aln.write(file='build_profile.ali', alignment_format='PIR')
File: build_profile.py
Note that while this script is written in the Python programming language,
it uses Modeller-specific commands, and should therefore be run by using a
command similar to the following at your command line:
mod9v1 build_profile.py
Note that the "mod9v1" script runs Modeller version 9v1. If you using
a different version of Modeller, you will need to adjust this command
accordingly - for example, if you have Modeller version 9.10 installed,
use "mod9.10" instead.
(You can get a command line using xterm or GNOME Terminal in Linux,
Terminal in Mac OS X, or the 'Modeller' link from your Start Menu in Windows.
For more information on running Modeller, see
the release notes. For more information
on using Python, see the Python web site.
Note that you can use other Python modules within your Modeller scripts, if
Python is correctly installed on your system.)
The profile.build() command has many options. In this
example rr_file is set to use the BLOSUM62 similarity matrix
(file "blosum62.sim.mat" provided in the
MODELLER distribution). Accordingly, the parameters
matrix_offset and gap_penalties_1d are set to
the appropriate values for the BLOSUM62 matrix. For this example, we will run
only one search iteration by setting the parameter
n_prof_iterations equal to 1. Thus, there is no need
for checking the profile for deviation (check_profile set to
False). Finally, the parameter max_aln_evalue is set to 0.01,
indicating that only sequences with e-values smaller than or equal to 0.01 will
be included in the final profile.
2. Selecting a template
The output of the "build_profile.py" script is
written to the "build_profile.log" file.
MODELLER always produces a log file. Errors and
warnings in log files can be found by searching for the "_E>" and
"_W>" strings, respectively.
MODELLER also writes the profile in text format to
the "build_profile.prf" file. An extract (omitting the aligned sequences)
of the output file can be seen next. The first 6 commented lines indicate the input parameters used in
MODELLER to build the profile. Subsequent lines correspond to the detected
similarities by profile.build().
# Number of sequences: 30
# Length of profile : 335
# N_PROF_ITERATIONS : 1
# GAP_PENALTIES_1D : -900.0 -50.0
# MATRIX_OFFSET : 0.0
# RR_FILE : ${MODINSTALL8v1}/modlib//as1.sim.mat
1 TvLDH S 0 335 1 335 0 0 0 0. 0.0
2 1a5z X 1 312 75 242 63 229 164 28. 0.83E-08
3 1b8pA X 1 327 7 331 6 325 316 42. 0.0
4 1bdmA X 1 318 1 325 1 310 309 45. 0.0
5 1t2dA X 1 315 5 256 4 250 238 25. 0.66E-04
6 1civA X 1 374 6 334 33 358 325 35. 0.0
7 2cmd X 1 312 7 320 3 303 289 27. 0.16E-05
8 1o6zA X 1 303 7 320 3 287 278 26. 0.27E-05
9 1ur5A X 1 299 13 191 9 171 158 31. 0.25E-02
10 1guzA X 1 305 13 301 8 280 265 25. 0.28E-08
11 1gv0A X 1 301 13 323 8 289 274 26. 0.28E-04
12 1hyeA X 1 307 7 191 3 183 173 29. 0.14E-07
13 1i0zA X 1 332 85 300 94 304 207 25. 0.66E-05
14 1i10A X 1 331 85 295 93 298 196 26. 0.86E-05
15 1ldnA X 1 316 78 298 73 301 214 26. 0.19E-03
16 6ldh X 1 329 47 301 56 302 244 23. 0.17E-02
17 2ldx X 1 331 66 306 67 306 227 26. 0.25E-04
18 5ldh X 1 333 85 300 94 304 207 26. 0.30E-05
19 9ldtA X 1 331 85 301 93 304 207 26. 0.10E-05
20 1llc X 1 321 64 239 53 234 164 26. 0.20E-03
21 1lldA X 1 313 13 242 9 233 216 31. 0.31E-07
22 5mdhA X 1 333 2 332 1 331 328 44. 0.0
23 7mdhA X 1 351 6 334 14 339 325 34. 0.0
24 1mldA X 1 313 5 198 1 189 183 26. 0.13E-05
25 1oc4A X 1 315 5 191 4 186 174 28. 0.18E-04
26 1ojuA X 1 294 78 320 68 285 218 28. 0.43E-05
27 1pzgA X 1 327 74 191 71 190 114 30. 0.16E-06
28 1smkA X 1 313 7 202 4 198 188 34. 0.0
29 1sovA X 1 316 81 256 76 248 160 27. 0.93E-03
30 1y6jA X 1 289 77 191 58 167 109 33. 0.32E-05
File: build_profile.prf
The most important columns in the profile.build() output
are the second, tenth, eleventh and twelfth columns. The second column reports
the code of the PDB sequence that was compared with the target sequence.
The PDB code in each line is the representative of a group of PDB sequences
that share 95% or more sequence identity to each other and have less than 30
residues or 30% sequence length difference. The eleventh column reports the
percentage sequence identities between TvLDH and a PDB sequence normalized by
the lengths of the alignment (indicated in the tenth column). In general,
a sequence identity value above approximately 25% indicates a potential
template unless the alignment is short (i.e., less than 100 residues). A
better measure of the significance of the alignment is given in the twelfth
column by the e-value of the alignment. In this example, six PDB sequences
show very significant similarities to the query sequence with e-values equal
to 0. As expected, all the hits correspond to malate dehydrogenases
(1bdm:A,
5mdh:A, 1b8p:A,
1civ:A, 7mdh:A, and
1smk:A). To select the most appropriate template for
our query sequence over the six similar structures, we will use the
alignment.compare_structures() command to assess the structural
and sequence similarity between the possible templates (file
"compare.py").
from modeller import *
env = environ()
aln = alignment(env)
for (pdb, chain) in (('1b8p', 'A'), ('1bdm', 'A'), ('1civ', 'A'),
('5mdh', 'A'), ('7mdh', 'A'), ('1smk', 'A')):
m = model(env, file=pdb, model_segment=('FIRST:'+chain, 'LAST:'+chain))
aln.append_model(m, atom_files=pdb, align_codes=pdb+chain)
aln.malign()
aln.malign3d()
aln.compare_structures()
aln.id_table(matrix_file='family.mat')
env.dendrogram(matrix_file='family.mat', cluster_cut=-1.0)
File: compare.py
In this case, we create an (initially empty) alignment object 'aln' and then
use a Python 'for' loop to instruct MODELLER to read each of the PDB files.
(Note that in order for this to work, you must have all of the PDB files in
the same directory as this script, either downloaded from the PDB website or
from the archive linked at the top of this page.) We use the
model_segment argument to ask only for a single chain to be
read from each PDB file (by default, all chains are read from the file). As
each structure is read in, we use the append_model method to
add the structure to the alignment.
At the end of the loop, all of the structures are in the alignment, but they
are not ideally aligned to each other (append_model creates
a simple 1:1 alignment with no gaps). Therefore, we improve this alignment by
using malign to calculate a multiple sequence alignment.
The malign3d command then performs an iterative least-squares
superposition of the six 3D structures, using the multiple sequence alignment
as its starting point. The
compare_structures command compares the structures according
to the alignment constructed by malign3d. It does not make an
alignment, but it calculates the RMS and DRMS deviations between atomic
positions and distances, differences between the mainchain and sidechain
dihedral angles, percentage sequence identities, and several other measures.
Finally, the id_table command writes a file with pairwise
sequence distances that can be used directly as the input to the
dendrogram command (or the clustering programs in the
PHYLIP package). dendrogram
calculates a clustering tree from the input matrix of pairwise distances,
which helps visualizing differences among the template candidates. Excerpts
from the log file are shown below (file
"compare.log").
Sequence identity comparison (ID_TABLE):
Diagonal ... number of residues;
Upper triangle ... number of identical residues;
Lower triangle ... % sequence identity, id/min(length).
1b8pA @11bdmA @11civA @25mdhA @27mdhA @21smkA @2
1b8pA @1 327 194 147 151 153 49
1bdmA @1 61 318 152 167 155 56
1civA @2 45 48 374 139 304 53
5mdhA @2 46 53 42 333 139 57
7mdhA @2 47 49 87 42 351 48
1smkA @2 16 18 17 18 15 313
Weighted pair-group average clustering based on a distance matrix:
.----------------------- 1b8pA @1.9 39.0000
|
.-------------------------------- 1bdmA @1.8 50.5000
|
.------------------------------------ 5mdhA @2.4 55.3750
|
| .--- 1civA @2.8 13.0000
| |
.---------------------------------------------------------- 7mdhA @2.4 83.2500
|
.------------------------------------------------------------ 1smkA @2.5
+----+----+----+----+----+----+----+----+----+----+----+----+
86.0600 73.4150 60.7700 48.1250 35.4800 22.8350 10.1900
79.7375 67.0925 54.4475 41.8025 29.1575 16.5125
Excerpts of the file compare.log
The comparison above shows that 1civ:A and
7mdh:A are almost identical, both sequentially and
structurally. However, 7mdh:A has a better
crystallographic resolution (2.4Å versus 2.8Å), eliminating
1civ:A. A second group of structures
(5mdh:A, 1bdm:A, and
1b8p:A) share some similarities. From this group,
5mdh:A has the poorest resolution leaving for
consideration only 1bdm:A and
1b8p:A. 1smk:A is the most
diverse structure of the whole set of possible templates. However, it is the
one with the lowest sequence identity (34%) to the query sequence. We finally
pick 1bdm:A over 1b8p:A and
7mdh:A because of its better crystallographic R-factor
(16.9%) and higher overall sequence identity to the query sequence (45%).
3. Aligning TvLDF with the template
A good way of aligning the sequence of TvLDH with the structure of
1bdm:A is the align2d() command in
MODELLER. Although align2d() is
based on a dynamic programming algorithm, it is different from standard
sequence-sequence alignment methods because it takes into account structural
information from the template when constructing an alignment. This task is
achieved through a variable gap penalty function that tends to place gaps in
solvent exposed and curved regions, outside secondary structure segments, and
between two positions that are close in space. As a result, the alignment
errors are reduced by approximately one third relative to those that occur
with standard sequence alignment techniques. This improvement becomes more
important as the similarity between the sequences decreases and the number
of gaps increases. In the current example, the template-target similarity
is so high that almost any alignment method with reasonable parameters will
result in the same alignment. The following MODELLER
script aligns the TvLDH sequence in file
"TvLDH.ali" with the
1bdm:A structure in the PDB file
"1bdm.pdb" (file
"align2d.py").
from modeller import *
env = environ()
aln = alignment(env)
mdl = model(env, file='1bdm', model_segment=('FIRST:A','LAST:A'))
aln.append_model(mdl, align_codes='1bdmA', atom_files='1bdm.pdb')
aln.append(file='TvLDH.ali', align_codes='TvLDH')
aln.align2d()
aln.write(file='TvLDH-1bdmA.ali', alignment_format='PIR')
aln.write(file='TvLDH-1bdmA.pap', alignment_format='PAP')
File: align2d.py
In this script, we again create an 'environ' object to use as input to
later commands. We create an empty alignment 'aln',
and then a new protein model 'mdl', into which we read the
chain A segment of the 1bdm PDB structure file. The
append_model() command transfers the PDB sequence of this
model to the alignment and assigns it the name of "1bdmA"
(align_codes). Then we add the "TvLDH" sequence from
file "TvLDH.seq" to the alignment, using the
append() command. The align2d() command is then
executed to align the two sequences. Finally, the alignment is written out in two
formats, PIR ("TvLDH-1bdmA.ali") and PAP
("TvLDH-1bdmA.pap"). The PIR format is used by
MODELLER in the subsequent model building stage,
while the PAP alignment format is easier to inspect visually. Due to the high
target-template similarity, there are only a few gaps in the alignment. In the
PAP format, all identical positions are marked with a "*" (file
"TvLDH-1bdmA.pap").
_aln.pos 10 20 30 40 50 60
1bdmA MKAPVRVAVTGAAGQIGYSLLFRIAAGEMLGKDQPVILQLLEIPQAMKALEGVVMELEDCAFPLLAGL
TvLDH MSEAAHVLITGAAGQIGYILSHWIASGELYG-DRQVYLHLLDIPPAMNRLTALTMELEDCAFPHLAGF
_consrvd * * ********* * ** ** * * * * ** ** ** * ********* ***
_aln.p 70 80 90 100 110 120 130
1bdmA EATDDPDVAFKDADYALLVGAAPRL---------QVNGKIFTEQGRALAEVAKKDVKVLVVGNPANTN
TvLDH VATTDPKAAFKDIDCAFLVASMPLKPGQVRADLISSNSVIFKNTGEYLSKWAKPSVKVLVIGNPDNTN
_consrvd ** ** **** * * ** * * ** * * ** ***** *** ***
_aln.pos 140 150 160 170 180 190 200
1bdmA ALIAYKNAPGLNPRNFTAMTRLDHNRAKAQLAKKTGTGVDRIRRMTVWGNHSSIMFPDLFHAEVD---
TvLDH CEIAMLHAKNLKPENFSSLSMLDQNRAYYEVASKLGVDVKDVHDIIVWGNHGESMVADLTQATFTKEG
_consrvd ** * * * ** ** *** * * * * ***** * ** *
_aln.pos 210 220 230 240 250 260 270
1bdmA -GRPALELVDMEWYEKVFIPTVAQRGAAIIQARGASSAASAANAAIEHIRDWALGTPEGDWVSMAVPS
TvLDH KTQKVVDVLDHDYVFDTFFKKIGHRAWDILEHRGFTSAASPTKAAIQHMKAWLFGTAPGEVLSMGIPV
_consrvd * * * * ** **** *** * * ** * ** *
_aln.pos 280 290 300 310 320 330
1bdmA Q--GEYGIPEGIVYSFPVTAK-DGAYRVVEGLEINEFARKRMEITAQELLDEMEQVKAL--GLI
TvLDH PEGNPYGIKPGVVFSFPCNVDKEGKIHVVEGFKVNDWLREKLDFTEKDLFHEKEIALNHLAQGG
_consrvd *** * * *** * **** * * * * * *
File: TvLDH-1bdmA.pap
4. Model building
Once a target-template alignment is constructed,
MODELLER calculates a 3D model of the target
completely automatically, using its automodel class. The
following script will generate five similar models of TvLDH based on the
1bdm:A template structure and the alignment in file
"TvLDH-1bdmA.ali" (file
"model-single.py").
from modeller import *
from modeller.automodel import *
env = environ()
a = automodel(env, alnfile='TvLDH-1bdmA.ali',
knowns='1bdmA', sequence='TvLDH',
assess_methods=(assess.DOPE, assess.GA341))
a.starting_model = 1
a.ending_model = 5
a.make()
File: model-single.py
The first line loads in the automodel class and prepares
it for use. We then create an automodel object, call it 'a',
and set parameters to guide the model building procedure.
alnfile names the file that contains the target-template
alignment in the PIR format. knowns defines the known template
structure(s) in alnfile
("TvLDH-1bdmA.ali"). sequence
defines the name of the target sequence in alnfile.
assess_methods requests one or more assessment scores
(discussed in more detail in the next section).
starting_model and ending_model define the
number of models that are calculated (their indices will run from 1 to 5).
The last line in the file calls the make method that
actually calculates the models.
The most important output file is
"model-single.log", which reports warnings,
errors and other useful information including the input restraints used for
modeling that remain violated in the final model. The last few lines from this
log file are shown below.
>> Summary of successfully produced models:
Filename molpdf DOPE score GA341 score
----------------------------------------------------------------------
TvLDH.B99990001.pdb 1763.56104 -38079.76172 1.00000
TvLDH.B99990002.pdb 1560.93396 -38515.98047 1.00000
TvLDH.B99990003.pdb 1712.44104 -37984.30859 1.00000
TvLDH.B99990004.pdb 1720.70801 -37869.91406 1.00000
TvLDH.B99990005.pdb 1840.91772 -38052.00781 1.00000
Excerpts of the file model-single.log
As you can see, the log file gives a summary of all the models built.
For each model, it lists the file name, which contains the coordinates of the
model in PDB format. The models can be viewed by any program that reads the
PDB format, such as Chimera. The log also shows the score(s) of each model,
which are further discussed below. (Note that the actual numbers may be
slightly different on your machine - this is nothing to worry about.)
5. Model evaluation
If several models are calculated for the same target, the "best" model
can be selected in several ways. For example, you could pick the model with
the lowest value of the MODELLER objective function
or the DOPE assessment score, or with the highest GA341 assessment score, all
of which are reported in the log file, above. (The objective function, molpdf,
is always calculated, and is also reported in a REMARK in each generated PDB
file. The DOPE and GA341 scores, or any other assessment scores, are
only calculated if you list them in assess_methods.)
The molpdf and DOPE scores are not 'absolute' measures, in the sense that they
can only be used to rank models calculated from the same alignment. Other
scores are transferable. For example GA341 scores always range from 0.0
(worst) to 1.0 (native-like); however GA341 is not as good as DOPE at
distinguishing 'good' models from 'bad' models.
Once a final model is selected, it can be further assessed in many ways.
Links to programs for model assessment can be found in
the MODEL EVALUATION section on
this page.
Before any external evaluation of the
model, one should check the log file from the modeling run for runtime errors
("model-single.log") and restraint violations
(see the MODELLER
manual for details). The file
"evaluate_model.py" evaluates an input model
with the DOPE potential. (Note that here we arbitrarily picked the second
generated model - you may want to try other models.)
from modeller import *
from modeller.scripts import complete_pdb
log.verbose() # request verbose output
env = environ()
env.libs.topology.read(file='$(LIB)/top_heav.lib') # read topology
env.libs.parameters.read(file='$(LIB)/par.lib') # read parameters
# read model file
mdl = complete_pdb(env, 'TvLDH.B99990002.pdb')
# Assess with DOPE:
s = selection(mdl) # all atom selection
s.assess_dope(output='ENERGY_PROFILE NO_REPORT', file='TvLDH.profile',
normalize_profile=True, smoothing_window=15)
File: evaluate_model.py
In this script we use the complete_pdb script to read in
a PDB file and prepare it for energy calculations (this automatically
allows for the possibility that the PDB file has
atoms in a non-standard order, or has different subsets of atoms, such as
all atoms including hydrogens, while MODELLER
uses only heavy atoms, or vice versa). We then create a selection of all atoms,
since most MODELLER energy functions can operate on
a subset of model atoms. The DOPE energy is then calculated
with the assess_dope command, and we additionally request an
energy profile, smoothed over a 15 residue window, and normalized by the
number of restraints acting on each residue. This profile is written to
a file "TvLDH.profile", which can be used as
input to a graphing program. For example, it could be plotted with
GNUPLOT using the command
'plot "TvLDH.profile" using 1:42 with lines'. Alternatively, you
can use the plot_profiles.py script included
in the tutorial zip file to plot profiles with the Python matplotlib
package.
The GA341 score, as well as external analysis with the
PROCHECK program, confirms that
TvLDH.B99990001.pdb is a
reasonable model. However, the plotted DOPE score profile (below) shows regions
of relatively high energy for the long active site loop between residues 90 and
100 and the long helices at the C-terminal end of the target sequence. (Note
that we have superposed the model profile on the template profile - gaps in the
plot can be seen corresponding to the gaps in the alignment. Remember that
the scores are not absolute, so we cannot make a direct numerical comparison
between the two. However, we can get an idea of the quality of our input
alignment this way by comparing the rough shapes of the two profiles - if one
is obviously shifted relative to the other, it is likely that the alignment
is also shifted from the correct one.)
DOPE score profiles for the model and templates
This long loop interacts with region 220-250, which forms the other half of
the active site. This latter part is well resolved in the template and probably
correctly modeled in the target structure, but due to the unfavorable
non-bonded interactions with the 90-100 region, it is also reported to be
of high "energy" by DOPE. In general, an possible error indicated by DOPE may
not necessarily be an actual error, especially if it highlights an active site
or a protein-protein interface. However, in this case, the same active site
loops have a better profile in the template structure, which strengthens the
assessment that the model is probably incorrect in the active site region.
This problem is addressed in the advanced modeling
tutorial.
|